PDB entry 2jj7

View 2jj7 on RCSB PDB site
Description: Crystal structure of the HlyIIR mutant protein with residues 170-185 substituted by alanine
Class: transcription
Keywords: DNA-binding protein, transcription regulation, DNA-binding, tetr family, transcription, transcriptional regulator
Deposited on 2008-03-18, released 2008-04-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolysin II regulatory protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JJ7 (169-169)
    • Uniprot Q7X506 (170-End)
    Domains in SCOPe 2.04: d2jj7a1, d2jj7a2
  • Chain 'B':
    Compound: hemolysin II regulatory protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JJ7 (169-169)
    • Uniprot Q7X506 (170-End)
    Domains in SCOPe 2.04: d2jj7b1, d2jj7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jj7A (A:)
    hmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfk
    kyglanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikp
    yfigsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidsadlvsriisal
    tdkpni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj7A (A:)
    asreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkky
    glanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyf
    igsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfdsadlvsriisaltdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jj7B (B:)
    hmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfk
    kyglanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikp
    yfigsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidsadlvsriisal
    tdkpni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj7B (B:)
    hmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfk
    kyglanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikp
    yfigsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidsadlvsriisal
    tdk