PDB entry 2jj6

View 2jj6 on RCSB PDB site
Description: crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein
Class: sugar-binding protein
Keywords: sugar-binding protein, human, galectin, carbohydrate recognition domain sugar-binding protein
Deposited on 2008-03-18, released 2008-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-related protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jj6a_
  • Chain 'B':
    Compound: galectin-related protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jj6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jj6A (A:)
    vpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqll
    rnscisgergeeqsaipyfpfipdqpfrveilcehprfrvfvdghqlfdfyhriqtlsai
    dtikingdlqitkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jj6B (B:)
    vpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqll
    rnscisgergeeqsaipyfpfipdqpfrveilcehprfrvfvdghqlfdfyhriqtlsai
    dtikingdlqitkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj6B (B:)
    pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr
    nscisgergeeqsaipyfpfipdqpfrveilcehprfrvfvdghqlfdfyhriqtlsaid
    tikingdlqitkl