PDB entry 2jj1

View 2jj1 on RCSB PDB site
Description: the structure of f1-ATPase inhibited by piceatannol.
Class: hydrolase
Keywords: hydrolase, mitochondrion, ATP-binding
Deposited on 2007-07-03, released 2007-08-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha heart isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase subunit alpha heart isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase subunit alpha heart isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: ATP synthase gamma chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2jj1g_
  • Chain 'H':
    Compound: ATP synthase subunit alpha heart isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ATP synthase subunit alpha heart isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ATP synthase subunit alpha heart isoform
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ATP synthase subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ATP synthase gamma chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2jj1n_
  • Heterogens: ANP, MG, GOL, ADP, AZI, PO4, PIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2jj1G (G:)
    atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
    edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
    sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
    ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
    emidkltltfnrtrqavitkelieiisgaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj1G (G:)
    atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
    vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
    sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2jj1N (N:)
    atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
    edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
    sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
    ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
    emidkltltfnrtrqavitkelieiisgaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj1N (N:)
    atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
    vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
    sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal