PDB entry 2jj1
View 2jj1 on RCSB PDB site
Description: the structure of f1-ATPase inhibited by piceatannol.
Class: hydrolase
Keywords: hydrolase, mitochondrion, ATP-binding
Deposited on
2007-07-03, released
2007-08-21
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ATP synthase subunit alpha heart isoform
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: ATP synthase subunit alpha heart isoform
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: ATP synthase subunit alpha heart isoform
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: ATP synthase subunit beta
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: ATP synthase subunit beta
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: ATP synthase subunit beta
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: ATP synthase gamma chain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2jj1g_ - Chain 'H':
Compound: ATP synthase subunit alpha heart isoform
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: ATP synthase subunit alpha heart isoform
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: ATP synthase subunit alpha heart isoform
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: ATP synthase subunit beta
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: ATP synthase subunit beta
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: ATP synthase subunit beta
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: ATP synthase gamma chain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2jj1n_ - Heterogens: ANP, MG, GOL, ADP, AZI, PO4, PIT, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
Sequence, based on SEQRES records: (download)
>2jj1G (G:)
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal
Sequence, based on observed residues (ATOM records): (download)
>2jj1G (G:)
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
Sequence, based on SEQRES records: (download)
>2jj1N (N:)
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal
Sequence, based on observed residues (ATOM records): (download)
>2jj1N (N:)
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal