PDB entry 2jix

View 2jix on RCSB PDB site
Description: Crystal structure of ABT-007 FAB fragment with the soluble domain of EPO receptor
Class: receptor/immune system
Keywords: immune system, receptor, transmembrane, receptor soluble domain, antibody, receptor-immune system complex
Deposited on 2007-07-02, released 2007-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.26
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: abt-007 fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIX (0-213)
  • Chain 'B':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jixb1, d2jixb2
  • Chain 'C':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jixc1, d2jixc2
  • Chain 'D':
    Compound: abt-007 fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIX (0-216)
    Domains in SCOPe 2.06: d2jixd1, d2jixd2
  • Chain 'E':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jixe1, d2jixe2
  • Chain 'F':
    Compound: abt-007 fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIX (0-216)
    Domains in SCOPe 2.06: d2jixf1, d2jixf2
  • Chain 'G':
    Compound: abt-007 fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIX (0-213)
  • Chain 'H':
    Compound: abt-007 fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIX (0-216)
    Domains in SCOPe 2.06: d2jixh1, d2jixh2
  • Chain 'L':
    Compound: abt-007 fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIX (0-213)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jixB (B:)
    apppnlpdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqle
    depwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvl
    ldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrte
    cvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jixB (B:)
    dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklc
    rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvgl
    varladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlr
    grtrytfavrarmaepsfggfwsawsepvslltpsdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jixC (C:)
    apppnlpdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqle
    depwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvl
    ldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrte
    cvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jixC (C:)
    kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
    hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglva
    rladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlrgr
    trytfavrarmaepsfggfwsawsepvslltpsdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jixD (D:)
    qvqlqesgpglvkpsetlsltctvsgasissyywswirqppgkglewigyiggegstnyn
    pslksrvtisvdtsknqfslklrsvtaadtavyycarerlgigdywgqgtlvtvssastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jixE (E:)
    apppnlpdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqle
    depwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvl
    ldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrte
    cvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jixE (E:)
    dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklc
    rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvgl
    varladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveilegrtecvlsnlr
    grtrytfavrarmaepsfggfwsawsepvslltpsdl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jixF (F:)
    qvqlqesgpglvkpsetlsltctvsgasissyywswirqppgkglewigyiggegstnyn
    pslksrvtisvdtsknqfslklrsvtaadtavyycarerlgigdywgqgtlvtvssastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jixH (H:)
    qvqlqesgpglvkpsetlsltctvsgasissyywswirqppgkglewigyiggegstnyn
    pslksrvtisvdtsknqfslklrsvtaadtavyycarerlgigdywgqgtlvtvssastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    No sequence available.