PDB entry 2jiu

View 2jiu on RCSB PDB site
Description: crystal structure of egfr kinase domain t790m mutation in complex with aee788
Class: transferase
Keywords: cell cycle, ATP-binding, transferase, nucleotide-binding, alternative splicing, egfr, t790m, kinase, aee788, receptor, tyrosine-protein kinase, epidermal growth factor, phosphorylation, disease mutation, anti-oncogene, transmembrane
Deposited on 2007-07-01, released 2008-01-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.214
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (95)
    Domains in SCOPe 2.05: d2jiua_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (0-End)
      • engineered mutation (95)
    Domains in SCOPe 2.05: d2jiub_
  • Heterogens: AEE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jiuA (A:)
    sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
    ankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyl
    lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
    kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
    qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
    snfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jiuA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspvvd
    adey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jiuB (B:)
    sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
    ankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyl
    lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
    kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
    qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
    snfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jiuB (B:)
    sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
    ankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyl
    lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
    kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
    qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
    snfyralmde