PDB entry 2ji5

View 2ji5 on RCSB PDB site
Description: structure of ump kinase from pyrococcus furiosus complexed with utp
Class: transferase
Keywords: amino acid kinase, phosphotranspherase, allosteric regulation, pyrimidine metabolism, kinase, ump kinase, transferase, uridylate kinase, pyrimidine biosynthesis
Deposited on 2007-02-26, released 2007-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.2094
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JI5 (0-1)
      • engineered mutation (196)
    • Uniprot Q8U122 (2-226)
    Domains in SCOPe 2.05: d2ji5a_
  • Chain 'B':
    Compound: uridylate kinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JI5 (Start-1)
      • engineered mutation (196)
    • Uniprot Q8U122 (2-226)
    Domains in SCOPe 2.05: d2ji5b_
  • Heterogens: UTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ji5A (A:)
    shmrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekf
    nssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpgh
    ttdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgieka
    gsssvidplaakiiartgiktivigkedakdlfrvikgdhngttiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ji5A (A:)
    shmrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekf
    nssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpgh
    ttdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgksvidp
    laakiiartgiktivigkedakdlfrvikgdhngttiep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ji5B (B:)
    shmrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekf
    nssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpgh
    ttdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgieka
    gsssvidplaakiiartgiktivigkedakdlfrvikgdhngttiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ji5B (B:)
    hmrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfn
    ssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpght
    tdavaallaeflkadllvvitnvdgvytadtakkikkmkpeelleivgsvidplaakiia
    rtgiktivigkedakdlfrvikgdhngttiep