PDB entry 2jhy

View 2jhy on RCSB PDB site
Description: crystal structure of rhogdi e155h, e157h mutant
Class: inhibitor
Keywords: surface entropy reduction, inhibitor, gtpase activation, crystal engineering
Deposited on 2007-02-23, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHY (0-1)
      • engineered mutation (90)
      • engineered mutation (92)
    • Uniprot P52565 (2-137)
    Domains in SCOPe 2.05: d2jhya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jhyA (A:)
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraehyhfltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw