PDB entry 2jhw

View 2jhw on RCSB PDB site
Description: crystal structure of rhogdi e155a, e157a mutant
Class: inhibitor
Keywords: surface entropy reduction, inhibitor, gtpase activation, crystal engineering
Deposited on 2007-02-23, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rho GDP-dissociation inhibitor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2JHW (0-1)
    • engineered mutation (90)
    • engineered mutation (92)
  • Uniprot P52565 (2-137)
  Domains in SCOPe 2.05: d2jhwa_
• Chain 'B':
  Compound: rho GDP-dissociation inhibitor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2JHW (0-1)
    • engineered mutation (90)
    • engineered mutation (92)
  • Uniprot P52565 (2-137)
  Domains in SCOPe 2.05: d2jhwb_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jhwA (A:)
  amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
  gmkyiqhtyrkgvkidktdymvgsygpraeayafltpveeapkgmlargsysiksrftdd
  dktdhlswewnltikkdw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jhwB (B:)
  amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
  gmkyiqhtyrkgvkidktdymvgsygpraeayafltpveeapkgmlargsysiksrftdd
  dktdhlswewnltikkdw