PDB entry 2jhu

View 2jhu on RCSB PDB site
Description: crystal structure of rhogdi e154a,e155a mutant
Class: inhibitor
Keywords: surface entropy reduction, inhibitor, acetylation, gtpase activation, crystal engineering
Deposited on 2007-02-23, released 2007-05-08
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.209
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho GDP-dissociation inhibitor 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHU (0-1)
      • engineered mutation (89-90)
    • Uniprot P52565 (2-137)
    Domains in SCOP 1.73: d2jhua1
  • Chain 'B':
    Compound: rho GDP-dissociation inhibitor 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHU (0-1)
      • engineered mutation (89-90)
    • Uniprot P52565 (2-137)
    Domains in SCOP 1.73: d2jhub1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhuA (A:)
    amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
    gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
    dktdhlswewnltikkdw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhuB (B:)
    amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
    gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
    dktdhlswewnltikkdw