PDB entry 2jhs

View 2jhs on RCSB PDB site
Description: crystal structure of rhogdi k135h,k138h,k141h mutant
Class: inhibitor
Keywords: surface entropy reduction, inhibitor, gtpase activation, crystal engineering
Deposited on 2007-02-23, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHS (Start-1)
      • engineered mutation (70)
      • engineered mutation (73)
      • engineered mutation (76)
    • Uniprot P52565 (2-137)
    Domains in SCOPe 2.05: d2jhsa_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jhsA (A:)
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrhgvhidhtdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

    Sequence, based on observed residues (ATOM records): (download) 
    >2jhsA (A:)
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
mkyiqhtyrhgvhidhtdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdw