PDB entry 2jhq

View 2jhq on RCSB PDB site
Description: crystal structure of uracil DNA-glycosylase from vibrio cholerae
Class: hydrolase
Keywords: structural analysis, mutational analysis, psychrophilic enzymes, uracil-DNA n- glycosylase, cold adaptation, vibrio cholerae, vibrio salmonicida, ung, hydrolase, DNA damage, DNA repair, glycosidase
Deposited on 2007-02-23, released 2008-06-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil DNA-glycosylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2jhqa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jhqA (A:)
    msesltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvi
    lgqdpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvl
    llntvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrh
    hvlmaphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jhqA (A:)
    sltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvilgq
    dpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvllln
    tvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrhhvl
    maphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles