PDB entry 2jho

View 2jho on RCSB PDB site
Description: cyanomet sperm whale myoglobin at 1.4a resolution
Class: oxygen transport
Keywords: oxygen transport, heme, iron, transport, metal-binding, muscle protein
Deposited on 2007-02-23, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.181
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon, synthetic [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHO
    • Uniprot P02185 (1-153)
    Domains in SCOPe 2.06: d2jhoa1
  • Heterogens: HEM, CYN, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jhoA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jhoA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg