PDB entry 2jhg

View 2jhg on RCSB PDB site
Description: structural evidence for a ligand coordination switch in liver alcohol dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, metal coordination, nad, zinc, inhibition, acetylation, metal-binding, alcohol dehydrogenase
Deposited on 2007-02-22, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.115
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jhga1, d2jhga2
  • Chain 'B':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jhgb1, d2jhgb2
  • Heterogens: ZN, NAD, IBO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhgA (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhgB (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf