PDB entry 2jh2

View 2jh2 on RCSB PDB site
Description: X-ray crystal structure of a cohesin-like module from Clostridium perfringens
Class: hydrolase
Keywords: hydrolase, glycosidase
Deposited on 2007-02-19, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jh2a1
  • Chain 'B':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jh2b_
  • Chain 'C':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jh2c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jh2A (A:)
    gshmasklkeaaevtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenaf
    eyveaisddgvfvnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvt
    nssvgdgeglvheiagtektvniiegts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jh2A (A:)
    evtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenafeyveaisddgvf
    vnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvtnssvgdgeglvh
    eiagtektvniie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jh2B (B:)
    gshmasklkeaaevtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenaf
    eyveaisddgvfvnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvt
    nssvgdgeglvheiagtektvniiegts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jh2B (B:)
    evtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenafeyveaisddgvf
    vnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvtnssvgdgeglvh
    eiagtektvniieg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jh2C (C:)
    gshmasklkeaaevtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenaf
    eyveaisddgvfvnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvt
    nssvgdgeglvheiagtektvniiegts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jh2C (C:)
    vtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenafeyveaisddgvfv
    nakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvtnssvgdgeglvhe
    iagtektvni