PDB entry 2jgc

View 2jgc on RCSB PDB site
Description: Structure of the human eIF4E homologous protein, 4EHP without ligand bound
Class: translation
Keywords: phosphorylation, initiation factor, 4ehp, eif4e, RNA-binding, acetylation, cap-binding, eukaryotic initiation factor, protein synthesis inhibitor, translation, protein biosynthesis, translation regulation
Deposited on 2007-02-12, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e type 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JGC
    • Uniprot O60573 (Start-194)
    Domains in SCOPe 2.08: d2jgca_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e-binding protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jgcA (A:)
gplhmkavvpgpaehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfys
hmvrpgdltghsdfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeq
fmvgeeicgavvsvrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtd
sikmpgrlgpqrllf

    Sequence, based on observed residues (ATOM records): (download) 
    >2jgcA (A:)
vvpgpaehplqynytfwysrrtpgrqnikqigtfasveqfwrfyshmvrpgdltghsdfh
lfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvr
fqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdgpqrllf

  • Chain 'B':
    No sequence available.