PDB entry 2jg0

View 2jg0 on RCSB PDB site
Description: family 37 trehalase from escherichia coli in complex with 1-thiatrehazolin
Class: hydrolase
Keywords: family 37, hydrolase, inhibitor, trehalase, glycoside hydrolase, periplasmic, glycosidase, 1-thiatrehazolin
Deposited on 2007-02-07, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.149
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg0a_
  • Heterogens: TTZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jg0A (A:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg0A (A:)
    pqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnv
    nftlpkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywd
    syftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaq
    hegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpes
    wvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnsl
    mfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnq
    ltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwva
    teglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqdgfgw
    tngvtlkmldlicpkeqpcdnvpatrp