PDB entry 2jfh

View 2jfh on RCSB PDB site
Description: crystal structure of murd ligase in complex with l-glu containing sulfonamide inhibitor
Class: ligase
Keywords: murd-inhibitor complex, peptidoglycan synthesis, ligase, cell wall, cell shape, cell cycle, nucleotide-binding, sulfonamide inhibitor, murd ligase, ATP-binding, cell division
Deposited on 2007-02-01, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoyl-alanine-d-glutamate ligase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JFH (438-End)
    • Uniprot P14900 (1-437)
    Domains in SCOPe 2.07: d2jfha1, d2jfha2, d2jfha3, d2jfha4
  • Heterogens: LK1, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jfhA (A:)
    madyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnd
    ewlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvt
    tlvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnv
    tedhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhl
    nhqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftgl
    phrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryl
    ngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqf
    knfeqrgnefarlakelgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jfhA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpircvsfgvnmgdyhlnetwlr
    vkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevvleh
    ngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrlycf
    grdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrgnef
    arlakelgshh