PDB entry 2jff

View 2jff on RCSB PDB site
Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
Class: ligase
Keywords: murd-inhibitor complex, peptidoglycan synthesis, ligase, cell wall, cell shape, cell cycle, nucleotide-binding, sulfonamide inhibitor, murd ligase, ATP-binding, cell division
Deposited on 2007-02-01, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanine--d-glutamate ligase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JFF (438-End)
    • Uniprot P14900 (1-437)
    Domains in SCOPe 2.06: d2jffa1, d2jffa2, d2jffa3, d2jffa4
  • Heterogens: LK2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jffA (A:)
    madyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnd
    ewlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvt
    tlvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnv
    tedhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhl
    nhqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftgl
    phrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryl
    ngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqf
    knfeqrgnefarlakelgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jffA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirrcvsfgvnmgdyhlnhqet
    wlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevv
    lehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrl
    ycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrg
    nefarlakelgsh