PDB entry 2jf4

View 2jf4 on RCSB PDB site
Description: family 37 trehalase from escherichia coli in complex with validoxylamine
Class: hydrolase
Keywords: family 37, hydrolase, inhibitor, trehalase, glycoside hydrolase, periplasmic, glycosidase, validoxylamine
Deposited on 2007-01-25, released 2007-02-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic trehalase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jf4a1
  • Heterogens: VDM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jf4A (A:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jf4A (A:)
    pqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnv
    nftlpqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywdsyftmlg
    laesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaqhegdaal
    kqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpeswvediat
    aksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnslmfkmeki
    laraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnqltaaalf
    plyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwvateglqny
    gqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqdgfgwtngvtlk
    mldlicpkeqpcdnvpatrp