PDB entry 2jf2

View 2jf2 on RCSB PDB site
Description: Nucleotide substrate binding by UDP-N-acetylglucosamine acyltransferase
Class: transferase
Keywords: lipid a biosynthesis, transferase, acyltransferase, lipid synthesis
Deposited on 2007-01-25, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.165
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JF2 (0-1)
    • Uniprot P0A722 (2-263)
    Domains in SCOPe 2.08: d2jf2a_
  • Heterogens: PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jf2A (A:)
    gsmidksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigr
    dneiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllm
    inahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgva
    qdvppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiae
    laetypevkaftdffarstrglir