PDB entry 2jf1

View 2jf1 on RCSB PDB site
Description: crystal structure of the filamin a repeat 21 complexed with the integrin beta2 cytoplasmic tail peptide
Class: cell adhesion
Keywords: actin-binding, cell adhesion, transmembrane, acetylation, polymorphism, cytoskeleton, glycoprotein, filamin, complex, membrane, integrin, receptor, pyrrolidone carboxylic acid, phosphorylation, disease mutation, immunoglobulin like
Deposited on 2007-01-25, released 2008-02-05
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-02, with a file datestamp of 2008-08-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24986
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-A
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • PDB 2JF1
  • Uniprot P21333
  Domains in SCOP 1.75: d2jf1a1
• Chain 'T':
  Compound: integrin beta-2 subunit
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05107
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jf1A (A:)
  gamggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgs
  cgvayvvqepgdyevsvkfneehipdspfvvpvasps
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jf1A (A:)
  gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfescgvayvvqe
  pgdyevsvkfneehipdspfvvpvasp
  

  
  
• Chain 'T':
  No sequence available.