PDB entry 2jew

View 2jew on RCSB PDB site
Description: Crystal structure of ((2S)-5-amino-2-((1-n-propyl-1H-imidazol-4-yl) methyl)pentanoic acid) UK396,082 a TAFIa inhibitor, Bound to Activated Porcine Pancreatic carboxypeptidaseB
Class: hydrolase
Keywords: carboxypeptidase, carboxypeptidase b, direct metal-binding, metalloprotease, protease, hydrolase, zinc, zymogen, exopeptidase
Deposited on 2007-01-24, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase b
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jewa_
  • Heterogens: ZN, 720, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jewA (A:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jewA (A:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl