PDB entry 2jen

View 2jen on RCSB PDB site
Description: family 12 xyloglucanase from bacillus licheniformis in complex with ligand
Class: hydrolase
Keywords: plant cell wall, glycosidase, xyloglucanase, hydrolase, family 12
Deposited on 2007-01-18, released 2007-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.116
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-glucanase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X4S4 (Start-260)
      • engineered mutation (154)
    Domains in SCOPe 2.06: d2jena_
  • Heterogens: DIO, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jenA (A:)
    mknnhllksillwgavciivlagplsafaasssnpsdklyfknkkyyifnnvwgadqvsg
    wwqtiyhnsdsdmgwvwnwpsntstvkaypsivsgwhwtegytagsgfptrlsdqknint
    kvsysisangtynaaydiwlhntnkaswdsaptdaimiwlnntnagpagsyvetvsiggh
    swkvykgyidagggkgwnvfsfirtantqsanlnirdftnyladskqwlsktkyvssvef
    gtevfggtgqinisnwdvtvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jenA (A:)
    aasssnpsdklyfknkkyyifnnvwgadqvsgwwqtiyhnsdsdmgwvwnwpsntstvka
    ypsivsgwhwtegytagsgfptrlsdqknintkvsysisangtynaaydiwlhntnkasw
    dsaptdaimiwlnntnagpagsyvetvsigghswkvykgyidagggkgwnvfsfirtant
    qsanlnirdftnyladskqwlsktkyvssvefgtevfggtgqinisnwdvtvr