PDB entry 2jel

View 2jel on RCSB PDB site
Description: jel42 fab/hpr complex
Deposited on 1998-02-24, released 1998-05-27
The last revision prior to the SCOP 1.69 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jelH (H:)
    qvqlaqsgpelvrpgvsvkisckgsgytfttyamhwvkqshakslewiglistysgytny
    nqkfkgkatmtvdkssstaymelarltsedsaiyycarvmgeqyfdvwgagttvivssaa
    ttppsvyplapgsggqgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlaadly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkiapg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jelL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhgngntylewylqkpgqspklliykisnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkigdgarqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktsdspivksfnrn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jelP (P:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele