PDB entry 2jel

View 2jel on RCSB PDB site
Description: jel42 fab/hpr complex
Class: complex (antibody/antigen)
Keywords: antibody-protein complex, histidine-containing protein, molecular recognition, complex (antibody/antigen)
Deposited on 1998-02-24, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: jel42 fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEL (0-217)
    Domains in SCOPe 2.07: d2jelh1, d2jelh2
  • Chain 'L':
    Compound: jel42 fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEL (0-216)
    Domains in SCOPe 2.07: d2jell1, d2jell2
  • Chain 'P':
    Compound: histidine-containing protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jelp_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jelH (H:)
    qvqlaqsgpelvrpgvsvkisckgsgytfttyamhwvkqshakslewiglistysgytny
    nqkfkgkatmtvdkssstaymelarltsedsaiyycarvmgeqyfdvwgagttvivssaa
    ttppsvyplapgsggqgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlaadly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkiapg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jelL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhgngntylewylqkpgqspklliykisnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkigdgarqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktsdspivksfnrn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jelP (P:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele