PDB entry 2jek

View 2jek on RCSB PDB site
Description: crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a
Class: structural genomics, unknown function
Keywords: MYCOBACTERIUM TUBERCULOSIS, STRUCTURAL GENOMICS, HYPOTHETICAL PROTEIN, RIGHT-HANDED SUPERHELIX, TB STRUCTURAL GENOMICS CONSORTIUM, UNKNOWN FUNCTION, TBSGC, PSI, Protein Structure Initiative
Deposited on 2007-01-17, released 2007-01-30
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.169
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rv1873
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2jeka1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jekA (A:)
    mksasdpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygis
    sleeaqaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanq
    dfvallakyygggedrrtvallavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jekA (A:)
    dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
    qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
    lakyygggedrrtvallavt