PDB entry 2jek

View 2jek on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein Rv1873 from Mycobacterium tuberculosis at 1.38 A
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function, mycobacterium tuberculosis, hypothetical protein, right-handed superhelix, tb structural genomics consortium, tbsgc, psi, protein structure initiative
Deposited on 2007-01-17, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rv1873
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jeka1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jekA (A:)
    mksasdpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygis
    sleeaqaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanq
    dfvallakyygggedrrtvallavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jekA (A:)
    dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
    qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
    lakyygggedrrtvallavt