PDB entry 2jej

View 2jej on RCSB PDB site
Description: the molecular basis of selectivity of nucleoside triphosphate incorporation opposite o6-benzylguanine by sulfolobus solfataricus DNA polymerase IV: steady-state and pre-steady-state kinetics and x-ray crystallography of correct and incorrect pairing
Class: transferase
Keywords: DNA replication, mutator protein, 06-benzylguanine, nucleotidyltransferase, DNA-directed DNA polymerase, dpo4, magnesium, polymerase, DNA damage, DNA repair, alkylating agents, translesion synthesis, transferase, DNA-binding, metal-binding
Deposited on 2007-01-17, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.238
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEJ (6-23)
    • Uniprot Q97W02 (6-End)
    Domains in SCOPe 2.07: d2jeja1, d2jeja2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *tp*tp*cp*cp*g)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*cp*ap*c bzgp*gp*ap*ap*tp*cp*cp *tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: CA, DGT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jejA (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jejA (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfie
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.