PDB entry 2jed

View 2jed on RCSB PDB site
Description: the crystal structure of the kinase domain of the protein kinase c theta in complex with nvp-xaa228 at 2.32a resolution.
Class: transferase
Keywords: phosphorylation, nucleotide-binding, serine/threonine-protein kinase, transferase, ATP-binding, polymorphism, metal-binding, zinc, kinase, pkc theta, magnesium, zinc-finger, alternative splicing, phorbol-ester binding
Deposited on 2007-01-16, released 2008-02-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.188
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c theta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04759
      • engineered mutation (20)
      • engineered mutation (177)
    • PDB 2JED
    Domains in SCOPe 2.05: d2jeda_
  • Chain 'B':
    Compound: protein kinase c theta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04759 (Start-345)
      • engineered mutation (20)
      • engineered mutation (177)
    • PDB 2JED (346-End)
    Domains in SCOPe 2.05: d2jedb_
  • Heterogens: LG8, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jedA (A:)
    epelnkerpslqiklkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdd
    dvectmvekrvlslawehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsr
    atfyaaeiilglqflhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefc
    gtpdyiapeillgqkynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfypr
    wlekeakdllvklfvrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfd
    csnfdkeflnekprlsfadralinsmdqnmfrnfsfmnpgmerlishhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jedA (A:)
    lkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlsl
    awehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqf
    lhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefcgtpdyiapeillgq
    kynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklf
    vrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdcsnfdkeflnekpr
    lsfadralinsmdqnmfrnfsfmnpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jedB (B:)
    epelnkerpslqiklkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdd
    dvectmvekrvlslawehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsr
    atfyaaeiilglqflhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefc
    gtpdyiapeillgqkynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfypr
    wlekeakdllvklfvrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfd
    csnfdkeflnekprlsfadralinsmdqnmfrnfsfmnpgmerlishhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jedB (B:)
    lkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlsl
    awehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqf
    lhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefcgtpdyiapeillgq
    kynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklf
    vrepekrlgvrgdirqhplfreinweelerkeidppfrpkvksprlsfadralinsmdqn
    mfrnfsfmnpgmerlishhhhh