PDB entry 2jec

View 2jec on RCSB PDB site
Description: crystal structure of recombinant dioclea grandiflora lectin mutant e123a-h131n-k132q complexed with 5-bromo-4-chloro-3-indolyl-a-d-mannose
Class: sugar-binding protein
Keywords: cona-like, metal-binding, legume lectin, carbohydrate binding protein, sugar-binding protein
Deposited on 2007-01-16, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lectin alpha chain
    Species: DIOCLEA GRANDIFLORA [TaxId:3837]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08902 (2-238)
      • expression tag (1)
      • engineered mutation (124)
      • engineered mutation (132-133)
      • conflict (156)
      • conflict (185)
    Domains in SCOPe 2.07: d2jeca1, d2jeca2
  • Chain 'B':
    Compound: Lectin alpha chain
    Species: DIOCLEA GRANDIFLORA [TaxId:3837]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08902 (2-238)
      • expression tag (1)
      • engineered mutation (124)
      • engineered mutation (132-133)
      • conflict (156)
      • conflict (185)
    Domains in SCOPe 2.07: d2jecb1, d2jecb2
  • Chain 'C':
    Compound: Lectin alpha chain
    Species: DIOCLEA GRANDIFLORA [TaxId:3837]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08902 (2-238)
      • expression tag (1)
      • engineered mutation (124)
      • engineered mutation (132-133)
      • conflict (156)
      • conflict (185)
    Domains in SCOPe 2.07: d2jecc1, d2jecc2
  • Chain 'D':
    Compound: Lectin alpha chain
    Species: DIOCLEA GRANDIFLORA [TaxId:3837]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08902 (2-238)
      • expression tag (1)
      • engineered mutation (124)
      • engineered mutation (132-133)
      • conflict (156)
      • conflict (185)
    Domains in SCOPe 2.07: d2jecd1, d2jecd2
  • Heterogens: CA, MN, XMM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jecA (A:)
    amadtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsva
    krlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktn
    siadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyap
    vhiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jecA (A:)
    madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
    rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
    iadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
    hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jecB (B:)
    amadtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsva
    krlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktn
    siadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyap
    vhiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jecB (B:)
    madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
    rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
    iadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
    hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jecC (C:)
    amadtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsva
    krlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktn
    siadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyap
    vhiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jecC (C:)
    madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
    rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
    iadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
    hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jecD (D:)
    amadtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsva
    krlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktn
    siadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyap
    vhiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jecD (D:)
    madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
    rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
    iadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
    hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan