PDB entry 2jeb

View 2jeb on RCSB PDB site
Description: structure of a 9-subunit archaeal exosome bound to mn ions
Class: hydrolase
Keywords: nuclease, hydrolase, RNA-binding, exonuclease, phosphorolytic, exoribonuclease, RNA degradation, RNA, rrp4, rrp42, rrp41, exosome, archaeal, RNAse ph
Deposited on 2007-01-16, released 2007-04-03
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEB (0-1)
      • engineered mutation (183)
    • Uniprot Q9UXC0 (2-276)
    Domains in SCOP 1.75: d2jeba1, d2jeba2
  • Chain 'B':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jebb1, d2jebb2
  • Chain 'I':
    Compound: exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, CL, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jebA (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsn
    gisvnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgi
    qksgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jebA (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisv
    nknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksg
    kgsmslqdidqaentarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jebB (B:)
    ghmremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaav
    ygpkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlve
    lfprtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildln
    eteamwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealks
    kyvefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jebB (B:)
    rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh
    lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf
    teilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlneteamwgead
    mpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    

  • Chain 'I':
    No sequence available.