PDB entry 2jea

View 2jea on RCSB PDB site
Description: structure of a 9-subunit archaeal exosome bound to RNA
Class: hydrolase/RNA
Keywords: hydrolase RNA complex, hydrolase-RNA complex, nuclease, hydrolase, RNA-binding, exonuclease, phosphorolytic, exoribonuclease, RNA degradation, rrp4, rrp42, rrp41, exosome, RNAse ph
Deposited on 2007-01-16, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEA (0-1)
    • Uniprot Q9UXC0 (2-276)
    Domains in SCOPe 2.06: d2jeaa1, d2jeaa2, d2jeaa3
  • Chain 'B':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEA
      • engineered mutation (183)
    • Uniprot Q9UXC2
    Domains in SCOPe 2.06: d2jeab1, d2jeab2
  • Chain 'C':
    Compound: RNA
  • Chain 'I':
    Compound: exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JEA
      • conflict (9)
    • Uniprot Q9UXC4
    Domains in SCOPe 2.06: d2jeai1, d2jeai2, d2jeai3
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jeaA (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsn
    gisvnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgi
    qksgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jeaA (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhis
    vnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqks
    gkgsmslqdidqaentarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jeaB (B:)
    ghmremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaav
    ygpkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlve
    lfprtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildln
    eteamwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealks
    kyvefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jeaB (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlneteamwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    

  • Chain 'C':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2jeaI (I:)
    ghmnmsqsqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqf
    eviplegsfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrr
    yldvgdyviarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetl
    tsksgcsifvanngriwatcpsrfseeilieairkieneshikgltdrikqfieeklger
    nassgetktns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jeaI (I:)
    qeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfeviplegs
    fyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdyv
    iarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetltsksifva
    nngriwafseeilieairkieneshik