PDB entry 2je6

View 2je6 on RCSB PDB site
Description: structure of a 9-subunit archaeal exosome
Class: hydrolase
Keywords: nuclease, hydrolase, RNA-binding, exonuclease, phosphorolytic, exoribonuclease, RNA degradation, RNA, rrp4, rrp42, rrp41, exosome, archaeal, RNAse ph
Deposited on 2007-01-15, released 2007-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JE6 (0-1)
      • engineered mutation (183)
      • conflict (9)
    • Uniprot Q9UXC0 (2-276)
    Domains in SCOPe 2.06: d2je6a1, d2je6a2, d2je6a3
  • Chain 'B':
    Compound: exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2je6b1, d2je6b2
  • Chain 'I':
    Compound: exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2je6i1, d2je6i2, d2je6i3
  • Heterogens: 1PE, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2je6A (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsn
    gisvnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgi
    qksgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2je6A (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhis
    vnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqks
    gkgsmslqdidqaentarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2je6B (B:)
    ghmremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaav
    ygpkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlve
    lfprtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildln
    eteamwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealks
    kyvefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2je6B (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlneteamwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2je6I (I:)
    ghmnmsqsqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqf
    eviplegsfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrr
    yldvgdyviarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetl
    tsksgcsifvanngriwatcpsrfseeilieairkieneshikgltdrikqfieeklger
    nassgetktns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2je6I (I:)
    qeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfeviplegs
    fyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdyv
    iarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetltsksifva
    nngriwafseeilieairkieneshik