PDB entry 2jdu

View 2jdu on RCSB PDB site
Description: mutant (g24n) of pseudomonas aeruginosa lectin II (pa-iil) complexed with methyl-a-l-fucopyranoside
Class: lectin
Keywords: lectin, glycomimetic, cystic fibrosis
Deposited on 2007-01-12, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.151
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYN5 (Start-114)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d2jdua_
  • Chain 'B':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYN5 (Start-114)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d2jdub_
  • Chain 'C':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYN5 (Start-114)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d2jduc_
  • Chain 'D':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYN5 (Start-114)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d2jdud_
  • Heterogens: GOL, SO4, CA, MFU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jduA (A:)
    matqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jduA (A:)
    atqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jduB (B:)
    matqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jduB (B:)
    atqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jduC (C:)
    matqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jduC (C:)
    atqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jduD (D:)
    matqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jduD (D:)
    atqgvftlpantrfgvtafanssntqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg