PDB entry 2jdr

View 2jdr on RCSB PDB site
Description: structure of pkb-beta (akt2) complexed with the inhibitor a-443654
Class: transferase
Keywords: wnt signaling pathway, serine/threonine-protein kinase, kinase, transferase, ATP-binding, phosphorylation, nucleotide-binding, alternative splicing
Deposited on 2007-01-12, released 2007-02-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JDR (Start-341)
    • Uniprot P31751 (5-End)
    Domains in SCOPe 2.05: d2jdra_
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: L20, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jdrA (A:)
    gamdpkvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvte
    srvlqntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeiv
    saleylhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksl
    lagllkkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfd
    deftaqsititppdrydslglleldqreeqemfedfdyiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdrA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsitqemfedfdyiadw
    

  • Chain 'C':
    No sequence available.