PDB entry 2jdk

View 2jdk on RCSB PDB site
Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Class: lectin
Keywords: pseudomonas aeruginosa, lectin, glycomimetic, cystic fibrosis
Deposited on 2007-01-10, released 2007-07-24
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-11, with a file datestamp of 2007-09-07.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.11277
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin PA-IIL
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jdka1
  • Chain 'B':
    Compound: Fucose-binding lectin PA-IIL
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jdkb1
  • Chain 'C':
    Compound: Fucose-binding lectin PA-IIL
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jdkc1
  • Chain 'D':
    Compound: Fucose-binding lectin PA-IIL
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jdkd1
  • Heterogens: FUC, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jdkA (A:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdkA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jdkB (B:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdkB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jdkC (C:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdkC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jdkD (D:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdkD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg