PDB entry 2jdd

View 2jdd on RCSB PDB site
Description: Glyphosate N-acetyltransferase bound to acetyl COA and 3-phosphoglycerate
Class: transferase
Keywords: gnat, glyphosate, transferase, n-acetyltransferase
Deposited on 2007-01-06, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyphosate n-acetyltransferase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JDD (Start-145)
    Domains in SCOPe 2.08: d2jdda_
  • Heterogens: ACO, 3PG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jddA (A:)
    mievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqae
    hselqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykk
    lgfseqgevfdtppvgphilmykrit
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jddA (A:)
    ievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqaeh
    selqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykkl
    gfseqgevfdtppvgphilmykrit