PDB entry 2jdc

View 2jdc on RCSB PDB site
Description: Structure and enzymatic mechanism of GAT
Class: transferase
Keywords: gnat, glyphosate, transferase, n-acetyltransferase
Deposited on 2007-01-05, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyphosate n-acetyltransferase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JDC (Start-145)
    Domains in SCOPe 2.08: d2jdca1
  • Heterogens: CAO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jdcA (A:)
    mievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqae
    hselqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykk
    lgfseqgevfdtppvgphilmykrit
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdcA (A:)
    ievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqaeh
    selqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykkl
    gfseqgevfdtppvgphilmykrit