PDB entry 2jd8

View 2jd8 on RCSB PDB site
Description: crystal structure of the zn-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Class: metal transport
Keywords: metal transport, ferritin, iron, archaeon, hyperthermophile, ferroxidase center, thermostability, entry channels, pores metal transport
Deposited on 2007-01-05, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd80_
  • Chain '1':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd81_
  • Chain '2':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd82_
  • Chain '3':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd83_
  • Chain '4':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd84_
  • Chain '5':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd85_
  • Chain '6':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd86_
  • Chain '7':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd87_
  • Chain '8':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd88_
  • Chain '9':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd89_
  • Chain 'A':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8a_
  • Chain 'B':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8b_
  • Chain 'C':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8c_
  • Chain 'D':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8d_
  • Chain 'E':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8e_
  • Chain 'F':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8f_
  • Chain 'G':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8g_
  • Chain 'H':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8h_
  • Chain 'I':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8i_
  • Chain 'J':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8j_
  • Chain 'K':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8k_
  • Chain 'L':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8l_
  • Chain 'M':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8m_
  • Chain 'N':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8n_
  • Chain 'O':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8o_
  • Chain 'P':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8p_
  • Chain 'Q':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8q_
  • Chain 'R':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8r_
  • Chain 'S':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8s_
  • Chain 'T':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8t_
  • Chain 'U':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8u_
  • Chain 'V':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8v_
  • Chain 'W':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8w_
  • Chain 'X':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8x_
  • Chain 'Y':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8y_
  • Chain 'Z':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd8z_
  • Heterogens: ZN, FE, SO4, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >2jd80 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd80 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2jd81 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd81 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2jd82 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd82 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >2jd83 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd83 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2jd84 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd84 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2jd85 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd85 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2jd86 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd86 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2jd87 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd87 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2jd88 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd88 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2jd89 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd89 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jd8A (A:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8A (A:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jd8B (B:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8B (B:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jd8C (C:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8C (C:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jd8D (D:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8D (D:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jd8E (E:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8E (E:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jd8F (F:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8F (F:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2jd8G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jd8H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2jd8I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2jd8J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2jd8K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2jd8L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2jd8M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2jd8N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2jd8O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2jd8P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2jd8Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2jd8R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2jd8S (S:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8S (S:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2jd8T (T:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8T (T:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2jd8U (U:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8U (U:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2jd8V (V:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8V (V:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2jd8W (W:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8W (W:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2jd8X (X:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8X (X:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2jd8Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2jd8Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd8Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg