PDB entry 2jd7

View 2jd7 on RCSB PDB site
Description: crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Class: metal transport
Keywords: metal transport, iron, pores, ferritin, archaeon, entry channels, thermostability, hyperthermophile, ferroxidase center metal transport
Deposited on 2007-01-05, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd70_
  • Chain '1':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd71_
  • Chain '2':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd72_
  • Chain '3':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd73_
  • Chain '4':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd74_
  • Chain '5':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd75_
  • Chain '6':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd76_
  • Chain '7':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd77_
  • Chain '8':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd78_
  • Chain '9':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd79_
  • Chain 'A':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7a_
  • Chain 'B':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7b_
  • Chain 'C':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7c_
  • Chain 'D':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7d_
  • Chain 'E':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7e_
  • Chain 'F':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7f_
  • Chain 'G':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7g_
  • Chain 'H':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7h_
  • Chain 'I':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7i_
  • Chain 'J':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7j_
  • Chain 'K':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7k_
  • Chain 'L':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7l_
  • Chain 'M':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7m_
  • Chain 'N':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7n_
  • Chain 'O':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7o_
  • Chain 'P':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7p_
  • Chain 'Q':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7q_
  • Chain 'R':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7r_
  • Chain 'S':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7s_
  • Chain 'T':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7t_
  • Chain 'U':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7u_
  • Chain 'V':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7v_
  • Chain 'W':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7w_
  • Chain 'X':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7x_
  • Chain 'Y':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7y_
  • Chain 'Z':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd7z_
  • Heterogens: FE, SO4, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >2jd70 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd70 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2jd71 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd71 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2jd72 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd72 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >2jd73 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd73 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2jd74 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd74 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2jd75 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd75 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2jd76 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd76 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2jd77 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd77 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2jd78 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd78 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2jd79 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd79 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jd7A (A:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7A (A:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jd7B (B:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7B (B:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jd7C (C:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7C (C:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jd7D (D:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7D (D:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jd7E (E:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7E (E:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jd7F (F:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7F (F:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2jd7G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jd7H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2jd7I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2jd7J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2jd7K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2jd7L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2jd7M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2jd7N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2jd7O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2jd7P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2jd7Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2jd7R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2jd7S (S:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7S (S:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2jd7T (T:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7T (T:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2jd7U (U:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7U (U:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2jd7V (V:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7V (V:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2jd7W (W:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7W (W:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2jd7X (X:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7X (X:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2jd7Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2jd7Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd7Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg