PDB entry 2jd6

View 2jd6 on RCSB PDB site
Description: crystal structure of the as isolated ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
Class: metal transport
Keywords: metal transport, iron, pores, ferritin, archaeon, entry channels, thermostability, hyperthermophile, ferroxidase center
Deposited on 2007-01-05, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd60_
  • Chain '1':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd61_
  • Chain '2':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd62_
  • Chain '3':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd63_
  • Chain '4':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd64_
  • Chain '5':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd65_
  • Chain '6':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd66_
  • Chain '7':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd67_
  • Chain '8':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd68_
  • Chain '9':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd69_
  • Chain 'A':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6a_
  • Chain 'B':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6b_
  • Chain 'C':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6c_
  • Chain 'D':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6d_
  • Chain 'E':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6e_
  • Chain 'F':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6f_
  • Chain 'G':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6g_
  • Chain 'H':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6h_
  • Chain 'I':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6i_
  • Chain 'J':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6j_
  • Chain 'K':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6k_
  • Chain 'L':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6l_
  • Chain 'M':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6m_
  • Chain 'N':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6n_
  • Chain 'O':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6o_
  • Chain 'P':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6p_
  • Chain 'Q':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6q_
  • Chain 'R':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6r_
  • Chain 'S':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6s_
  • Chain 'T':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6t_
  • Chain 'U':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6u_
  • Chain 'V':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6v_
  • Chain 'W':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6w_
  • Chain 'X':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6x_
  • Chain 'Y':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6y_
  • Chain 'Z':
    Compound: ferritin homolog
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jd6z_
  • Heterogens: FE, SO4, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >2jd60 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd60 (0:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2jd61 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd61 (1:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2jd62 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd62 (2:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >2jd63 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd63 (3:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2jd64 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd64 (4:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2jd65 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd65 (5:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2jd66 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd66 (6:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2jd67 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd67 (7:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2jd68 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd68 (8:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2jd69 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd69 (9:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jd6A (A:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6A (A:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jd6B (B:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6B (B:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jd6C (C:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6C (C:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jd6D (D:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6D (D:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jd6E (E:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6E (E:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jd6F (F:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6F (F:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2jd6G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6G (G:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jd6H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6H (H:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2jd6I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6I (I:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2jd6J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6J (J:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2jd6K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6K (K:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2jd6L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6L (L:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2jd6M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6M (M:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2jd6N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6N (N:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2jd6O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6O (O:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2jd6P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6P (P:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2jd6Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6Q (Q:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2jd6R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6R (R:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2jd6S (S:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6S (S:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2jd6T (T:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6T (T:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2jd6U (U:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6U (U:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2jd6V (V:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6V (V:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2jd6W (W:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6W (W:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2jd6X (X:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6X (X:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2jd6Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6Y (Y:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2jd6Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllmqgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd6Z (Z:)
    mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
    iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
    ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg