PDB entry 2jd4

View 2jd4 on RCSB PDB site
Description: mouse laminin alpha1 chain, domains lg4-5
Class: metal binding protein
Keywords: laminin-111, basement membrane protein, metal binding protein
Deposited on 2007-01-04, released 2007-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2295
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laminin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JD4 (0-3)
      • engineered mutation (36)
      • engineered mutation (133)
      • engineered mutation (222)
      • engineered mutation (336)
    • Uniprot P19137 (4-382)
    Domains in SCOPe 2.05: d2jd4a1
  • Chain 'B':
    Compound: laminin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JD4
      • engineered mutation (36)
      • engineered mutation (133)
      • engineered mutation (222)
      • engineered mutation (336)
    • Uniprot P19137 (Start-382)
    Domains in SCOPe 2.05: d2jd4b1, d2jd4b2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jd4A (A:)
    aplaqpelcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgli
    yyvahqnqmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmt
    vdgqespsvtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqld
    kdrplsasavdrcyvvaqegtffegsgyaalvkegykvrldlqitlefrttskngvllgi
    ssakvdaigleivdgkvlfhvnngagritatyqpraaralcdgkwhtlqahkskhrivlt
    vdgnsvraesphthstsadtndpiyvggypahikqnslssrasfrgcvrnlrlsrgsqvq
    sldlsrafdlqgvfphscpgpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd4A (A:)
    aplaqpelcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgli
    yyvahqnqmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmt
    vdgqespsvtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqld
    kdrplsasavdrcyvvaqegtffegsgyaalvkegykvrldlqitlefrttskngvllgi
    ssakvdaigleivdgkvlfhvnngagritatyqpraaralcdgkwhtlqahkskhrivlt
    vdgnsvraehstsadtndpiyvggypahikqnslssrasfrgcvrnlrlsqvqsldlsra
    fdlqgvfphscpgpep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jd4B (B:)
    aplaqpelcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgli
    yyvahqnqmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmt
    vdgqespsvtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqld
    kdrplsasavdrcyvvaqegtffegsgyaalvkegykvrldlqitlefrttskngvllgi
    ssakvdaigleivdgkvlfhvnngagritatyqpraaralcdgkwhtlqahkskhrivlt
    vdgnsvraesphthstsadtndpiyvggypahikqnslssrasfrgcvrnlrlsrgsqvq
    sldlsrafdlqgvfphscpgpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jd4B (B:)
    lcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgliyyvahqn
    qmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmtvdgqesp
    svtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqldkdrplsa
    savdrcyvvaqegtffegsgyaalvkegykvrldlqitlefrttskngvllgissakvda
    igleivdgkvlfhvnngagritatyqpraaralcdgkwhtlqahkskhrivltvdgnsvr
    aesphthstsadtndpiyvggypahikqnslssrasfrgcvrnlrlsrgsqvqsldlsra
    fdlqgvfphscpgpep