PDB entry 2jcj

View 2jcj on RCSB PDB site
Description: Crystal structure of alpha-1,3 Galactosyltransferase (C-terminus truncated mutant-C3) in complex with UDP and Tris
Class: transferase
Keywords: substrate specificity, 3 galactosyltransferase, alpha-1, enzyme mechanism, glycosyltransferase galactosyltransferase, transmembrane, golgi apparatus, glycoprotein, metal-binding, signal-anchor, membrane, manganese, transferase, glycosyltransferase
Deposited on 2006-12-25, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jcja_
  • Heterogens: UDP, MN, MPD, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jcjA (A:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jcjA (A:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvr