PDB entry 2jcg

View 2jcg on RCSB PDB site
Description: apo form of the catabolite control protein a (ccpa) from bacillus megaterium, with the DNA binding domain
Class: transcription
Keywords: megaterium, DNA-binding, transcription, ccpa, bacillus, apo- form, activator, repressor, transcription regulation, catabolite control protein a
Deposited on 2006-12-22, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (Start-331)
      • conflict (104)
      • conflict (319)
    Domains in SCOPe 2.07: d2jcga1, d2jcga2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jcgA (A:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivelphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jcgA (A:)
    vtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavtttvgviipdi
    snifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgiifmsgnvtee
    hveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkniafvsgtleep
    inhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekptaifvgtdem
    algvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigavamrlltkymn
    ketvdssivelphriefrqstk