PDB entry 2jc6

View 2jc6 on RCSB PDB site
Description: crystal structure of human calmodulin-dependent protein kinase 1d
Class: transferase
Keywords: transferase, ATP-binding, nuclear protein, phosphorylation
Deposited on 2006-12-19, released 2007-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium/calmodulin-dependent protein kinase type 1d
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jc6a_
  • Chain 'C':
    Compound: calcium/calmodulin-dependent protein kinase type 1d
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jc6c_
  • Heterogens: QPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jc6A (A:)
    smarengesssswkkqaedikkifefketlgtgafsevvlaeekatgklfavkcipkkal
    kgkessieneiavlrkikhenivalediyespnhlylvmqlvsggelfdrivekgfytek
    dastlirqvldavyylhrmgivhrdlkpenllyysqdeeskimisdfglskmegkgdvms
    tacgtpgyvapevlaqkpyskavdcwsigviayillcgyppfydendsklfeqilkaeye
    fdspywddisdsakdfirnlmekdpnkrytceqaarhpwiagdtalnknihesvsaqirk
    nfakskwrqafnatavvrhmrklhlgssldssna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc6A (A:)
    swkkqaedikkifefketlgtgafsevvlaeekatgklfavkcipkkassieneiavlrk
    ikhenivalediyespnhlylvmqlvsggelfdrivekgfytekdastlirqvldavyyl
    hrmgivhrdlkpenllyysqdeeskimispgyvapevlaqkpyskavdcwsigviayill
    cgyppfydendsklfeqilkaeyefdspywddisdsakdfirnlmekdpnkrytceqaar
    hpwiagdtalnknihesvsaqirknfakskwrqafnat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jc6C (C:)
    smarengesssswkkqaedikkifefketlgtgafsevvlaeekatgklfavkcipkkal
    kgkessieneiavlrkikhenivalediyespnhlylvmqlvsggelfdrivekgfytek
    dastlirqvldavyylhrmgivhrdlkpenllyysqdeeskimisdfglskmegkgdvms
    tacgtpgyvapevlaqkpyskavdcwsigviayillcgyppfydendsklfeqilkaeye
    fdspywddisdsakdfirnlmekdpnkrytceqaarhpwiagdtalnknihesvsaqirk
    nfakskwrqafnatavvrhmrklhlgssldssna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc6C (C:)
    swkkqaedikkifefketlgtgafsevvlaeekatgklfavkcipkkasieneiavlrki
    khenivalediyespnhlylvmqlvsggelfdrivekgfytekdastlirqvldavyylh
    rmgivhrdlkpenllyysqdeeskimispgyvapevlaqkpyskavdcwsigviayillc
    gyppfydendsklfeqilkaeyefdspywddisdsakdfirnlmekdpnkrytceqaarh
    pwiagdtalnknihesvsaqirknfakskwrqafnat