PDB entry 2jc2

View 2jc2 on RCSB PDB site
Description: the crystal structure of the natural f112l human sorcin mutant
Class: metal binding protein
Keywords: ryanodine receptor interacting protein, calcium binding protein, natural f112l sorcin mutant, calcium, metal binding protein
Deposited on 2006-12-19, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.254
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sorcin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30626 (Start-197)
      • engineered mutation (111)
    Domains in SCOPe 2.07: d2jc2a_
  • Chain 'B':
    Compound: sorcin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30626 (Start-197)
      • engineered mutation (111)
    Domains in SCOPe 2.07: d2jc2b_
  • Chain 'C':
    Compound: sorcin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30626 (Start-197)
      • engineered mutation (111)
    Domains in SCOPe 2.07: d2jc2c_
  • Chain 'D':
    Compound: sorcin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30626 (Start-197)
      • engineered mutation (111)
    Domains in SCOPe 2.07: d2jc2d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jc2A (A:)
    maypghpgagggyypggyggapggpafpgqtqdplygyfaavagqdgqidadelqrcltq
    sgiaggykpfnletcrlmvsmldrdmsgtmgfnefkelwavlngwrqhfisldtdrsgtv
    dpqelqkalttmgfrlspqavnsiakrystngkitfddyiaccvklraltdsfrrrdtaq
    qgvvnfpyddfiqcvmsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc2A (A:)
    dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf
    nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng
    kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jc2B (B:)
    maypghpgagggyypggyggapggpafpgqtqdplygyfaavagqdgqidadelqrcltq
    sgiaggykpfnletcrlmvsmldrdmsgtmgfnefkelwavlngwrqhfisldtdrsgtv
    dpqelqkalttmgfrlspqavnsiakrystngkitfddyiaccvklraltdsfrrrdtaq
    qgvvnfpyddfiqcvmsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc2B (B:)
    dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf
    nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng
    kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jc2C (C:)
    maypghpgagggyypggyggapggpafpgqtqdplygyfaavagqdgqidadelqrcltq
    sgiaggykpfnletcrlmvsmldrdmsgtmgfnefkelwavlngwrqhfisldtdrsgtv
    dpqelqkalttmgfrlspqavnsiakrystngkitfddyiaccvklraltdsfrrrdtaq
    qgvvnfpyddfiqcvmsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc2C (C:)
    dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf
    nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng
    kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jc2D (D:)
    maypghpgagggyypggyggapggpafpgqtqdplygyfaavagqdgqidadelqrcltq
    sgiaggykpfnletcrlmvsmldrdmsgtmgfnefkelwavlngwrqhfisldtdrsgtv
    dpqelqkalttmgfrlspqavnsiakrystngkitfddyiaccvklraltdsfrrrdtaq
    qgvvnfpyddfiqcvmsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc2D (D:)
    dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf
    nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng
    kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv