PDB entry 2jbz

View 2jbz on RCSB PDB site
Description: crystal structure of the streptomyces coelicolor holo-[acyl-carrier-protein] synthase (acps) in complex with coenzyme a at 1.6 a
Class: transferase
Keywords: acp, magnesium, coenzyme a, transferase, poliketides, metal- binding, lipid synthesis, phosphopantetheine arm, fatty acid biosynthesis, acyl carrier protein synthase
Deposited on 2006-12-15, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Holo-[acyl-carrier-protein] synthase
  Species: Streptomyces coelicolor [TaxId:1902]
  Database cross-references and differences (RAF-indexed):
  • PDB 2JBZ (Start-19)
  • Uniprot O86785 (20-142)
  Domains in SCOPe 2.08: d2jbza1, d2jbza2
• Heterogens: MG, K, COA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jbzA (A:)
  mgsshhhhhhssglvprgshmsiigvgidvaeverfgaalertpalagrlfleselllpg
  gerrgvaslaarfaakealakalgapagllwtdaevwveaggrprlrvtgtvaaraaelg
  vaswhvslshdagiasavviaeg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jbzA (A:)
  hmsiigvgidvaeverfgaalertpalagrlfleselllpggerrgvaslaarfaakeal
  akalgapagllwtdaevwveaggrprlrvtgtvaaraaelgvaswhvslshdagiasavv
  iaeg