PDB entry 2jbo

View 2jbo on RCSB PDB site
Description: protein kinase mk2 in complex with an inhibitor (crystal form-1, soaking)
Class: transferase
Keywords: ser-thr kinase, mapkap kinase 2, phosphorylation, mk2, kinase, ATP site, transferase, ATP-binding, serine/threonine-protein kinase, small molecule inhibitor, nucleotide-binding
Deposited on 2006-12-09, released 2007-03-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.232
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jboa_
  • Heterogens: PO4, P4O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jboA (A:)
    gsqqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdc
    pkarrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaf
    tereaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshn
    slttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktr
    irmgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplht
    srvlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jboA (A:)
    pqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarr
    evelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterea
    seimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettcytpyyva
    pevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpew
    sevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedke