PDB entry 2jbk

View 2jbk on RCSB PDB site
Description: membrane-bound glutamate carboxypeptidase II (gcpii) in complex with quisqualic acid (quisqualate, alpha-amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic acid)
Class: hydrolase
Keywords: multifunctional enzyme, neurodegenerative disease, glycoprotein, metal-binding, signal-anchor, hydrolase, naaladase, dipeptidase, polymorphism, zinc, psma, antigen, membrane, protease, peptidase, transmembrane, signal- anchor, metal- binding, metalloprotease, prostate cancer, carboxypeptidase,
Deposited on 2006-12-07, released 2006-12-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2jbka1, d2jbka2, d2jbka3
  • Heterogens: NAG, ZN, CA, CL, QUS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jbkA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jbkA (A:)
    nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
    lsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvy
    vnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfa
    pgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhp
    igyydaqkllekmggsappdsswrgslkvpynvgpgftfstqkvkmhihstnevtriynv
    igtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrtilf
    aswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvhnlt
    kelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgraryt
    knfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdcrdyavv
    lrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdksnpivlrm
    mndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskvdpsk
    awgevkrqiyvaaftvqaaaetlseva