PDB entry 2jbg

View 2jbg on RCSB PDB site
Description: crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7
Class: hydrolase/inhibitor complex
Keywords: zinc, toxin, plasmid, nuclease, hydrolase, hydrolase/inhibitor complex, antibiotic, h-n-h motif, bacteriocin, endonuclease, metal-binding, antimicrobial, DNA hydrolysis, bacteriocin immunity, his metal finger motif
Deposited on 2006-12-07, released 2007-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: colicin-e7 immunity protein
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03708 (0-86)
  Domains in SCOP 1.73: d2jbga1
• Chain 'B':
  Compound: colicin e7
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47112 (Start-130)
    • engineered mutation (114)
• Chain 'C':
  Compound: colicin-e7 immunity protein
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03708 (0-86)
  Domains in SCOP 1.73: d2jbgc1
• Chain 'D':
  Compound: colicin e7
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47112 (Start-130)
    • engineered mutation (114)
• Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jbgA (A:)
  melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
  rddspegivkeikewraangkpgfkqg
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jbgC (C:)
  melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
  rddspegivkeikewraangkpgfkqg
  

  
  
• Chain 'D':
  No sequence available.